.
The Open Protein Structure Annotation Network
PDB Keyword
.

2kk8

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title NMR Solution Structure of a Putative Uncharacterized Protein obtained from Arabidopsis thaliana: Northeast Structural Genomics Consortium Target AR3449A. To be Published
    Site NESGC
    PDB Id 2kk8 Target Id AR3449A
    Molecular Characteristics
    Source Arabidopsis thaliana
    Alias Ids TPS28296,3.10.20.90, PF00240, 16355 Molecular Weight 8428.27 Da.
    Residues 74 Isoelectric Point 4.61
    Sequence mkflvenlngssfelevdyrdtllvvkqkiersqhipvskqtlivdgivilredltveqcqivptsdiq levss
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch