.
The Open Protein Structure Annotation Network
PDB Keyword
.

2kke

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title NMR Solution Structure of a putative uncharacterized protein from Methanobacterium thermoautotrophicum, Northeast Structural Genomics Consortium Target:TR5. To be Published
    Site NESGC
    PDB Id 2kke Target Id TR5
    Molecular Characteristics
    Source Methanothermobacter thermautotrophicus
    Alias Ids TPS28449,16357 Molecular Weight 5948.58 Da.
    Residues 53 Isoelectric Point 9.39
    Sequence mvgrrpggglkdtkpvvvrlypdeiealksrvpantsmsayirriilnhledd
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 2

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2kke
    1. Influence of 1 H chemical shift assignments of the interface residues on structure determinations of homodimeric proteins
    YJ Lin, DK Kirchner, P Gntert - Journal of Magnetic Resonance, 2012 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch