The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution NMR structure of yeast protein YOR252W. To be Published
    Site NESGC
    PDB Id 2kkm Target Id YT654
    Molecular Characteristics
    Source Saccharomyces cerevisiae
    Alias Ids TPS28455,16365, PF11176 Molecular Weight 16648.13 Da.
    Residues 141 Isoelectric Point 9.47
    Sequence mredkiaakkklhqdkrvhelarvkfmqdvvnsdtfkgqpifdhahtrefiqsfierddteldelkkkr rsnrppsnrqvllqqrrdqelkefkagflcpdlsdaknmeflrnwngtfgllntlrlirindkgeqvvg gne
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch