.
The Open Protein Structure Annotation Network
PDB Keyword
.

2kkn

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution NMR structure of Themotoga maritima protein TM1076. To be Published
    Site NESGC
    PDB Id 2kkn Target Id VT57
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS31718,3.60.21.10, 16366 Molecular Weight 17613.39 Da.
    Residues 157 Isoelectric Point 5.06
    Sequence mkrfllisdshvpvrmaslpdeilnslkeydgviglgdyvdldtvillekfskefygvhgnmdypdvke hlpfskvllvegvtigmchgwgapwdlkdrllkvfnekpqvilfghthepedtvkagvrflnpgslaeg syavleldggevrfelktl
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch