The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution NMR structure of the phage integrase SAM-like Domain from Moth 1796 from Moorella thermoacetica. Northeast Structural Genomics Consortium Target MtR39K (residues 64-171). To be Published
    Site NESGC
    PDB Id 2kkp Target Id MtR39K
    Molecular Characteristics
    Source Moorella thermoacetica
    Alias Ids TPS28395,, 16369 Molecular Weight 12426.70 Da.
    Residues 108 Isoelectric Point 9.63
    Sequence iepskitveqwlnrwltdyakphlrqstwesyetvlrlhviptlgsiplkklqpadiqrlyasklesgl sptrvryihvvlheamsqaresglllqnpteaakpprhp
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch