The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution NMR Structure of the Ig-like C2-type 2 Domain of Human Myotilin. Northeast Structural Genomics Target HR3158. To be Published
    Site NESGC
    PDB Id 2kkq Target Id HR3158
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS28349,PF07686, PF07679,, 16370 Molecular Weight 55392.23 Da.
    Residues 498 Isoelectric Point 9.12
    Sequence mfnyerpkhfiqsqnpcgsrlqppgpetssfssqtkqssiiiqprqcteqrfsasstlsshitmsssaf paspqqhagsnpgqrvtttynqspasflssilpsqpdynsskipsamdsnyqqssagqpinakpsqtan akpiprtpdheiqgskealiqdlerklkckdtllhngnqrltyeekmarrllgpqnaaavfqaqddsga qdsqqhnseharlqvptsqvrsrstsrgdvndqdaiqekfypprfiqvpenmsidegrfcrmdfkvsgl papdvswylngrtvqsddlhkmivsekglhslifevvrasdagayacvaknrageatftvqldvlakeh krapmfiykpqskkvlegdsvklecqisaipppklfwkrnnemvqfntdrislyqdntgrvtllikdvn kkdagwytvsavneagvttcntrldvtarpnqtlpapkqlrvrptfskylalngkglnvkqafnpegef qrlaaqsglyeseel
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch