.
The Open Protein Structure Annotation Network
PDB Keyword
.

2kks

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution Structure Of Protein DSY2949 From Desulfitobacterium hafniense. Northeast Structural Genomics Consortium Target DhR27. To be Published
    Site NESGC
    PDB Id 2kks Target Id DhR27
    Molecular Characteristics
    Source Desulfitobacterium hafniense
    Alias Ids TPS28322,3.40.140.10, 16371, PF01398 Molecular Weight 15728.16 Da.
    Residues 138 Isoelectric Point 5.61
    Sequence mitltkkqmeemlaharqalpneacgllggrrdgddrwvervyplnnldqspehfsmdpreqltavkdm rkngwvmlgnfhshpatparpsaedkrlafdpslsyliislaepqkpvcksflikkdgvdeeeiilkee
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch