.
The Open Protein Structure Annotation Network
PDB Keyword
.

2kku

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of protein af2351 from Archaeoglobus fulgidus. Northeast Structural Genomics Consortium target AtT9/Ontario Center for Structural Proteomics Target af2351. To be Published
    Site NESGC
    PDB Id 2kku Target Id AtT9
    Molecular Characteristics
    Source Agrobacterium tumefaciens
    Alias Ids TPS28302,PF04033, 16372 Molecular Weight 16658.90 Da.
    Residues 139 Isoelectric Point 9.96
    Sequence mskivgvtypipkrfmdrffkkgkdvfvkpatvwkelkpgmkfvfyqshedtgfvgearikrvvlsenp mqffetfgdrvfltkdelkeymksqerwgrrreskkkklwmaieledvkkydkpikpkrlvpvggqylre
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2kku
    1. A novel strategy for NMR resonance assignment and protein structure determination
    A Lemak, A Gutmanas, S Chitayat, M Karra - Journal of biomolecular , 2011 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch