.
The Open Protein Structure Annotation Network
PDB Keyword
.

2kkx

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title NleG Type 3 effectors from enterohaemorrhagic Escherichia coli are U-Box E3 ubiquitin ligases. Plos Pathog. 6 e1000960-e1000960 2010
    Site NESGC
    PDB Id 2kkx Target Id ET109A
    Related PDB Ids 2kky 
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS28334,PF06416, 16375, 16374 Molecular Weight 11191.17 Da.
    Residues 101 Isoelectric Point 5.07
    Sequence qesiqnkisqckfsvcperlqcpleaiqcpitleqpekgifvknsdgsdvctlfdaaafsrlvgeglph pltrepitasiivkheeciyddtrgnfiikgn
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2kkx
    1. Hijacking the host ubiquitin pathway: structural strategies of bacterial E3 ubiquitin ligases
    SW Hicks, JE Galn - Current opinion in microbiology, 2010 - Elsevier
     
    2. NleG Type 3 effectors from enterohaemorrhagic Escherichia coli are U-Box E3 ubiquitin ligases
    B Wu, T Skarina, A Yee, MC Jobin, R DiLeo, A Semesi - PLoS , 2010 - dx.plos.org
     
    3. A novel strategy for NMR resonance assignment and protein structure determination
    A Lemak, A Gutmanas, S Chitayat, M Karra - Journal of biomolecular , 2011 - Springer
     
    4. Blind testing of routine, fully automated determination of protein structures from NMR data
    A Rosato, JM Aramini, C Arrowsmith, A Bagaria - Structure, 2012 - Elsevier
     
    5. Frontiers: Interactions of Bacterial Proteins with Host Eukaryotic Ubiquitin Pathways
    CA Perrett, DY Lin, D Zhou - Frontiers in Cellular And Infection , 2011 - frontiersin.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch