.
The Open Protein Structure Annotation Network
PDB Keyword
.

2kl1

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution Structure of GtR34C. To be Published
    Site NESGC
    PDB Id 2kl1 Target Id GtR34C
    Molecular Characteristics
    Source Geobacillus thermodenitrificans
    Alias Ids TPS28346,16378, PF00595, 2.30.42.10 Molecular Weight 9502.37 Da.
    Residues 86 Isoelectric Point 8.36
    Sequence neakgvyvmsvlpnmpaagrleagdriaaidgqpintseqivsyvrekqagdrvrvtfirdrkqheael vlkpfphhpnqiglgvt
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2kl1
    1. Small angle X_ray scattering as a complementary tool for high_throughput structural studies
    TD Grant, JR Luft, JR Wolfley, H Tsuruta, A Martel - , 2011 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch