.
The Open Protein Structure Annotation Network
PDB Keyword
.

2kl3

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution NMR structure of the Rhodanese-like domain from Anabaena sp Alr3790 protein. Northeast Structural Genomics Consortium Target NsR437A. To be Published
    Site NESGC
    PDB Id 2kl3 Target Id NsR437A
    Molecular Characteristics
    Source Nostoc sp. pcc 7120
    Alias Ids TPS28405,3.40.250.10, PF00581, 16382 Molecular Weight 13321.00 Da.
    Residues 123 Isoelectric Point 4.74
    Sequence epqsdahvlksrlewgepaftildvrdrstyndghimgamampiedlvdrasssleksrdiyvygagde qtsqavnllrsagfehvselkgglaawkaiggptegiiesrtpagaddynvvsr
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch