The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution NMR Structure of the EGF-like 1 Domain of Human Fibulin-4. Northeast Structural Genomics Target HR6275. To be Published
    Site NESGC
    PDB Id 2kl7 Target Id HR6275
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS28364,PF07645, 16386, Molecular Weight 7482.95 Da.
    Residues 70 Isoelectric Point 4.40
    Sequence dvnecltipeackgemkcinhyggylclprsaavindlhgegppppvppaqhpnpcppgyepddqdscvd
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 2kl7
    1. Prdiction de structures de macromolcules par apprentissage automatique
    A Marcos Alvarez - 2011 - orbi.ulg.ac.be

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch