.
The Open Protein Structure Annotation Network
PDB Keyword
.

2klb

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title NMR Solution structure of a diflavin flavoprotein A3 from Nostoc sp. PCC 7120, Northeast Structural Genomics Consortium Target NsR431C. To be Published
    Site NESGC
    PDB Id 2klb Target Id NsR431C
    Molecular Characteristics
    Source Nostoc sp. pcc 7120
    Alias Ids TPS28401,3.40.50.360, 16388 Molecular Weight 15391.54 Da.
    Residues 146 Isoelectric Point 4.58
    Sequence sigvfyvseygysdrlaqaiingitktgvgvdvvdlgaavdlqelrelvgrctglvigmspaasaasiq galstilgsvnekqavgifetgggddepidpllskfrnlglttafpairikqtptentyklceeagtdl gqwvtrdr
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2klb
    1. Electron Crystallography: Electron Microscopy and Electron Diffraction
    X Zou, S Hovmller, P Oleynikov - 2011 - books.google.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch