.
The Open Protein Structure Annotation Network
PDB Keyword
.

2kmm

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution NMR structure of the TGS domain of PG1808 from Porphyromonas gingivalis. Northeast Structural Genomics Consortium Target PgR122A (418-481). To be Published
    Site NESGC
    PDB Id 2kmm Target Id PgR122A
    Molecular Characteristics
    Source Porphyromonas gingivalis
    Alias Ids TPS31805,PF02824, 16434, 3.10.20.30 Molecular Weight 6911.54 Da.
    Residues 64 Isoelectric Point 6.30
    Sequence evmvftpkgeikrlpqgataldfayslhsdlgdhcigakvnhklvplsyvlnsgdqvevlssks
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2kmm
    1. Blind testing of routine, fully automated determination of protein structures from NMR data
    A Rosato, JM Aramini, C Arrowsmith, A Bagaria - Structure, 2012 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch