.
The Open Protein Structure Annotation Network
PDB Keyword
.

2knr

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution NMR structure of protein atc0905 from A. tumefaciens. To be Published
    Site NESGC
    PDB Id 2knr Target Id AtT13
    Molecular Characteristics
    Source Agrobacterium tumefaciens
    Alias Ids TPS31834,PF07372, 16476 Molecular Weight 13257.27 Da.
    Residues 118 Isoelectric Point 4.79
    Sequence mrlksemfvsalirrvfaaggfaavekkgaeaagaifvrqrlrdgrenlygpapqsfaddedimraerr fetrlagvegeeiaallererrfdsdlwvveietdeigtlltlvdqpqa
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2knr
    1. Predicting protein structures with a multiplayer online game
    S Cooper, F Khatib, A Treuille, J Barbero, J Lee - Nature, 2010 - nature.com
     
    2. A novel strategy for NMR resonance assignment and protein structure determination
    A Lemak, A Gutmanas, S Chitayat, M Karra - Journal of biomolecular , 2011 - Springer
     
    3. Blind testing of routine, fully automated determination of protein structures from NMR data
    A Rosato, JM Aramini, C Arrowsmith, A Bagaria - Structure, 2012 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch