.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ko1

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution NMR structure of the ACT domain from GTP pyrophosphokinase of Chlorobium tepidum. To be Published
    Site NESGC
    PDB Id 2ko1 Target Id CtR148A
    Related PDB Ids 3ibw 
    Molecular Characteristics
    Source Chlorobium tepidum
    Alias Ids TPS31806,16486, 3.30.70.260 Molecular Weight 7631.70 Da.
    Residues 68 Isoelectric Point 9.65
    Sequence irivgedkigmtnqitgviskfdtnirtivlnakdgiftcnlmifvkntdklttlmdklrkvqgvftv
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 2

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2ko1
    1. Small angle X_ray scattering as a complementary tool for high_throughput structural studies
    TD Grant, JR Luft, JR Wolfley, H Tsuruta, A Martel - , 2011 - Wiley Online Library
     
    2. Influence of 1 H chemical shift assignments of the interface residues on structure determinations of homodimeric proteins
    YJ Lin, DK Kirchner, P Gntert - Journal of Magnetic Resonance, 2012 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch