.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ko6

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution Structure of protein sf3929 from Shigella flexneri 2a. Northeast Structural Genomics Consortium target SfR81/Ontario Center for Structural Proteomics Target sf3929. To be Published
    Site NESGC
    PDB Id 2ko6 Target Id SfR81
    Molecular Characteristics
    Source Shigella flexneri
    Alias Ids TPS31736,16490, PF06288 Molecular Weight 10306.37 Da.
    Residues 89 Isoelectric Point 5.18
    Sequence mkckrlneviellqpawqkepdfnllqflqklakesgfdgeladltddiliyhlkmrdsakdavipglq kdyeedfktallrargvike
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2ko6
    1. RNA polymerase and transcription elongation factor Spt4/5 complex structure
    BJ Klein, D Bose, KJ Baker, ZM Yusoff - Proceedings of the , 2011 - National Acad Sciences
     
    2. A novel strategy for NMR resonance assignment and protein structure determination
    A Lemak, A Gutmanas, S Chitayat, M Karra - Journal of biomolecular , 2011 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch