The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution NMR structure of CLOLEP_01837 (fragment 61-160) from Clostridium leptum. Northeast Structural Genomics Consortium Target QlR8A. To be Published
    Site NESGC
    PDB Id 2kob Target Id QlR8A
    Molecular Characteristics
    Source Clostridium leptum
    Alias Ids TPS31807,, 16498 Molecular Weight 11104.10 Da.
    Residues 98 Isoelectric Point 9.34
    Sequence sfgdwaekflkskeadgvsvsqlnsyknycrnhlsplymkslseilpadiqsiinetklakntlkairn tasqifrlaienraidfnpadyvripkia
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch