.
The Open Protein Structure Annotation Network
PDB Keyword
.

2kon

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title NMR solution structure of CV_2116 from Chromobacterium violaceum.Northeast Structural Genomics Consortium Target CvT4(1-82). To be Published
    Site NESGC
    PDB Id 2kon Target Id CvT4
    Molecular Characteristics
    Source Chromobacterium violaceum
    Alias Ids TPS31837,16521 Molecular Weight 9399.07 Da.
    Residues 82 Isoelectric Point 5.41
    Sequence mnvahyrgyeiepghqyrddirkyvpyalirkvgvpdrtpipatypefydleadaervsiacakiiids hldrhdqgladlg
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2kon
    1. Solution NMR Structure of Hypothetical Protein CV_2116 Encoded by a Viral Prophage Element in Chromobacterium violaceum
    Y Yang, TA Ramelot, JR Cort, M Garcia, A Yee - International Journal of , 2012 - mdpi.com
     
    2. Structure and function of hemoproteins from cold-adapted organism
    R Russo - 2011 - fedoa.unina.it
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch