.
The Open Protein Structure Annotation Network
PDB Keyword
.

2kp6

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of protein CV0237 from Chromobacterium violaceum. TO BE PUBLISHED
    Site NESGC
    PDB Id 2kp6 Target Id CvT1
    Molecular Characteristics
    Source Chromobacterium violaceum
    Alias Ids TPS31836,16545, PF10982 Molecular Weight 8690.29 Da.
    Residues 79 Isoelectric Point 4.25
    Sequence mdtsnhllpglfrqlgledepaairafidshplpprvplpeapfwtpaqaaflrqalecdaewseaade lavllqqgea
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2kp6
    1. A novel strategy for NMR resonance assignment and protein structure determination
    A Lemak, A Gutmanas, S Chitayat, M Karra - Journal of biomolecular , 2011 - Springer
     
    2. Structure-oriented methods for protein NMR data analysis
    GA Bermejo, M Llins - Progress in nuclear magnetic resonance , 2010 - ncbi.nlm.nih.gov
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch