.
The Open Protein Structure Annotation Network
PDB Keyword
.

2kpj

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution Structure Of Protein SOS-response transcriptional repressor, LexA From Eubacterium rectale. Northeast Structural Genomics Consortium Target ErR9A. To be Published
    Site NESGC
    PDB Id 2kpj Target Id ErR9A
    Molecular Characteristics
    Source Eubacterium rectale
    Alias Ids TPS31825,PF01381, 1.10.1680.10, 1.10.260.40, 16557 Molecular Weight 11862.96 Da.
    Residues 109 Isoelectric Point 5.44
    Sequence fsenlnsyiaksektqleiaksigvspqtfntwckgiaiprmgkvqaladyfninksdliedkklnidt vpiesgytipvlgrvaagygkeaveevigqieispsmaak
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2kpj
    1. Prdiction de structures de macromolcules par apprentissage automatique
    A Marcos Alvarez - 2011 - orbi.ulg.ac.be
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch