.
The Open Protein Structure Annotation Network
PDB Keyword
.

2kpm

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution NMR Structure of uncharacterized protein from gene locus NE0665 of Nitrosomonas europaea. Northeast Structural Genomics Target NeR103A. To be Published
    Site NESGC
    PDB Id 2kpm Target Id NeR103A
    Molecular Characteristics
    Source Nitrosomonas europaea
    Alias Ids TPS31817,16560, BIG_751 Molecular Weight 9104.66 Da.
    Residues 82 Isoelectric Point 6.12
    Sequence spqpaaqapetkqafprkfvlaaleqssddagwanlgnfgnylnklqpdfdsrlygykklsdlvkartd lfvteerqvpgst
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2kpm
    1. Predicting protein structures with a multiplayer online game
    S Cooper, F Khatib, A Treuille, J Barbero, J Lee - Nature, 2010 - nature.com
     
    2. Blind testing of routine, fully automated determination of protein structures from NMR data
    A Rosato, JM Aramini, C Arrowsmith, A Bagaria - Structure, 2012 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch