The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution NMR structure of a Bacterial Ig-like (Big_3) domain from Bacillus cereus. Northeast Structural Genomics Consortium target BcR147A. To be Published
    Site NESGC
    PDB Id 2kpn Target Id BcR147A
    Molecular Characteristics
    Source Bacillus cereus
    Alias Ids TPS31818,PF07523, 16561, Molecular Weight 9002.73 Da.
    Residues 84 Isoelectric Point 4.85
    Sequence sdlepkltvpvgatihvgdsfvpmaevlaidkedgdltskikvdgevdttkagtyvltytvtdskghev takqtvtvkvreevk
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Metals CA (CALCIUM) x 1



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch