.
The Open Protein Structure Annotation Network
PDB Keyword
.

2kpp

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution NMR structure of Lin0431 protein from Listeria innocua reveals high structural similarity with domain II of bacterial transcription antitermination protein NusG. Proteins 78 2563-2568 2010
    Site NESGC
    PDB Id 2kpp Target Id LkR112
    Related PDB Ids 3ld7 
    Molecular Characteristics
    Source Listeria innocua
    Alias Ids TPS31768,16563, 2.60.320.10, PF07009 Molecular Weight 15599.39 Da.
    Residues 140 Isoelectric Point 7.82
    Sequence mrqymkmvrpfdfviivalilgsflplllfsvaeakntgdevvaiisqngkvireipltghkgneqfti kgkgaqynlmevdgeririkednspdqvgvkmgwkskagdtivclphkvfveikstqkdskdpdtdliv pn
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2kpp
    1. Small angle X_ray scattering as a complementary tool for high_throughput structural studies
    TD Grant, JR Luft, JR Wolfley, H Tsuruta, A Martel - , 2011 - Wiley Online Library
     
    2. Solution NMR structure of Lin0431 protein from Listeria innocua reveals high structural similarity with domain II of bacterial transcription antitermination protein NusG
    Y Tang, R Xiao, C Ciccosanti, H Janjua - Proteins: Structure, , 2010 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch