.
The Open Protein Structure Annotation Network
PDB Keyword
.

2kps

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution Structure of Domain IV from the YbbR family protein of Desulfitobacterium hafniense. To be Published
    Site NESGC
    PDB Id 2kps Target Id DhR29A
    Molecular Characteristics
    Source Desulfitobacterium hafniense
    Alias Ids TPS31823,16568 Molecular Weight 9223.31 Da.
    Residues 82 Isoelectric Point 5.07
    Sequence lpivlrnlpedlvlekplpevsvtiraypeilnnltkeqislwidatgkavgehtvkiywqlpagiemv sipdvtytlkake
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch