.
The Open Protein Structure Annotation Network
PDB Keyword
.

2kpt

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution NMR structure of the N-terminal domain of cg2496 protein from Corynebacterium glutamicum. To be Published
    Site NESGC
    PDB Id 2kpt Target Id CgR26A
    Molecular Characteristics
    Source Corynebacterium glutamicum
    Alias Ids TPS31819,PF04536, 16569 Molecular Weight 11884.15 Da.
    Residues 114 Isoelectric Point 3.68
    Sequence gqisssditniqaaiddvkaseqkvifvvflssfdgvdpetwtqqalqangggnvliyalapeerqygi qggtqwtdaeldaannaafqalsqedwagsalalaesvgssssss
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2kpt
    1. Predicting protein structures with a multiplayer online game
    S Cooper, F Khatib, A Treuille, J Barbero, J Lee - Nature, 2010 - nature.com
     
    2. Blind testing of routine, fully automated determination of protein structures from NMR data
    A Rosato, JM Aramini, C Arrowsmith, A Bagaria - Structure, 2012 - Elsevier
     
    3. Solution NMR structures reveal a distinct architecture and provide first structures for protein domain family PF04536
    A Eletsky, TB Acton, R Xiao, JK Everett - Journal of Structural and , 2011 - Springer
     
    4. Positive modulation of a Cys-loop acetylcholine receptor by an auxiliary transmembrane subunit
    T Boulin, G Rapti, L Briseo-Roa, C Stigloher - Nature , 2012 - nature.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch