.
The Open Protein Structure Annotation Network
PDB Keyword
.

2kpw

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title NMR solution structure of Lamin-B1 protein from Homo sapiens: Northeast Structural Genomics Consortium target, HR5546A (439-549). To be Published
    Site NESGC
    PDB Id 2kpw Target Id HR5546A
    Related PDB Ids 3jt0 
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS31757,2.60.40.1260, 16572, PF00932 Molecular Weight 14571.36 Da.
    Residues 133 Isoelectric Point 4.76
    Sequence asssvsishsasatgnvcieeidvdgkfirlkntseqdqpmggwemirkigdtsvsykytsryvlkagq tvtiwaanagvtaspptdliwknqnswgtgedvkvilknsqgeevaqrstvfkttipeeeeeee
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch