.
The Open Protein Structure Annotation Network
PDB Keyword
.

2kq1

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution Structure Of Protein BH0266 From Bacillus halodurans. To be Published
    Site NESGC
    PDB Id 2kq1 Target Id BhR97A
    Molecular Characteristics
    Source Bacillus halodurans
    Alias Ids TPS31831,16576, PF07949 Molecular Weight 11104.73 Da.
    Residues 98 Isoelectric Point 4.37
    Sequence ptfdhgnlslgeleltvlydeerydiveqtetvqvdlegprgvltvfrfarpsyevfvdlteagegsht vdvehrgfpgdlavtveprmarvqleerq
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2kq1
    1. Combining NMR ensembles and molecular dynamics simulations provides more realistic models of protein structures in solution and leads to better chemical shift
    J Lehtivarjo, K Tuppurainen, T Hassinen - Journal of Biomolecular , 2012 - Springer
     
    2. Structures of domains I and IV from YbbR are representative of a widely distributed protein family
    AW Barb, JR Cort, J Seetharaman, S Lew - Protein , 2011 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch