.
The Open Protein Structure Annotation Network
PDB Keyword
.

2kq8

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution NMR structure of a domain from BT9727_4915 from Bacillus thuringiensis, Northeast Structural Genomics Consortium Target BuR95A. To be Published
    Site NESGC
    PDB Id 2kq8 Target Id BuR95A
    Molecular Characteristics
    Source Bacillus thuringiensis
    Alias Ids TPS31821,2.30.30.40, 16592, PF06347, PF08239 Molecular Weight 5960.33 Da.
    Residues 55 Isoelectric Point 9.87
    Sequence nasalnvrsgegtnyriigalpqgqkvqvisensgwskinyngqtgyigtrylsk
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch