.
The Open Protein Structure Annotation Network
PDB Keyword
.

2kq9

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution Structure of DnaK protein from Agrobacterium tumefaciens C58. Northeast Structural Genomics Consortium target AtT12/Ontario Center for Structural Proteomics Target atc0888. To be Published
    Site NESGC
    PDB Id 2kq9 Target Id AtT12
    Molecular Characteristics
    Source Agrobacterium tumefaciens
    Alias Ids TPS31833,16594, PF01258 Molecular Weight 12634.41 Da.
    Residues 112 Isoelectric Point 4.97
    Sequence maggksmnvesyekilrdrqrelyrrlhkieadfeeprnpddedrasersndevldelgqvgqdelrai daalariasgtfgtcvkcgkrisedrlkavpytpfcqecaaal
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals ZN (ZINC) x 1

    Jmol

     
    Google Scholar output for 2kq9
    1. A novel strategy for NMR resonance assignment and protein structure determination
    A Lemak, A Gutmanas, S Chitayat, M Karra - Journal of biomolecular , 2011 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch