.
The Open Protein Structure Annotation Network
PDB Keyword
.

2kr1

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of zinc binding domain of human ubiquitin ligase E3A isoform 2. To be Published
    Site NESGC
    PDB Id 2kr1 Target Id HR3662A
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS31747,16620 Molecular Weight 18449.95 Da.
    Residues 163 Isoelectric Point 6.89
    Sequence meklhqcywksgepqsddieasrmkraaakhlieryyhqltegcgneactnefcascptflrmdnnaaa ikalelykinaklcdphpskkgassaylenskgapnnscseikmnkkgaridfkdvtylteekvyeile lcreredysplirvigrvfssaeal
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals ZN (ZINC) x 1

    Jmol

     
    Google Scholar output for 2kr1
    1. A novel strategy for NMR resonance assignment and protein structure determination
    A Lemak, A Gutmanas, S Chitayat, M Karra - Journal of biomolecular , 2011 - Springer
     
    2. Zn-binding AZUL domain of human ubiquitin protein ligase Ube3A
    A Lemak, A Yee, I Bezsonova, S Dhe-Paganon - Journal of biomolecular , 2011 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch