.
The Open Protein Structure Annotation Network
PDB Keyword
.

2krk

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution NMR Structure of 26S protease regulatory subunit 8 from H.sapiens, Northeast Structural Genomics Consortium Target HR3102A. To be Published
    Site NESGC
    PDB Id 2krk Target Id HR3102A
    Related PDB Ids 3kw6 
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS31826,16640, 3.40.50.300, 1.10.8.60 Molecular Weight 8539.50 Da.
    Residues 76 Isoelectric Point 9.02
    Sequence pneearldilkihsrkmnltrginlrkiaelmpgasgaevkgvcteagmyalrerrvhvtqedfemava kvmqkds
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch