The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution NMR structure of SH3 domain from CPF_0587 (fragment 415-479) from Clostridium perfringens. Northeast Structural Genomics Consortium (NESG) Target CpR74A. To be Published
    Site NESGC
    PDB Id 2krs Target Id CpR74A
    Molecular Characteristics
    Source Clostridium perfringens
    Alias Ids TPS31816,, PF06347, PF08239, 16647 Molecular Weight 6095.58 Da.
    Residues 55 Isoelectric Point 9.16
    Sequence vnsalnmrsgpgsnygvigtlrnndkveiikevdgwyeirfngkvgyasksyiti
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch