The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution NMR structure of the PCP_red domain of light-independent protochlorophyllide reductase subunit B from Chlorobium tepidum. Northeast Structural Genomics Consortium Target CtR69A. To be Published
    Site NESGC
    PDB Id 2kru Target Id CtR69A
    Molecular Characteristics
    Source Chlorobium tepidum
    Alias Ids TPS31838,PF08369, BIG_274, 16649 Molecular Weight 5604.26 Da.
    Residues 48 Isoelectric Point 9.77
    Sequence wtaeaekmlgkvpffvrkkvrkntdnyareigepvvtadvfrkakehl
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 2kru
    1. Blind testing of routine, fully automated determination of protein structures from NMR data
    A Rosato, JM Aramini, C Arrowsmith, A Bagaria - Structure, 2012 - Elsevier
    2. Combining NMR ensembles and molecular dynamics simulations provides more realistic models of protein structures in solution and leads to better chemical shift
    J Lehtivarjo, K Tuppurainen, T Hassinen - Journal of Biomolecular , 2012 - Springer

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch