.
The Open Protein Structure Annotation Network
PDB Keyword
.

2krx

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution NMR structure of asl3597 from Nostoc sp. PCC7120. Northeast Structural Genomics Consortium target NsR244. To be Published
    Site NESGC
    PDB Id 2krx Target Id NsR244
    Molecular Characteristics
    Source Nostoc sp. pcc 7120
    Alias Ids TPS31752,16652, BIG_1287, PF12095 Molecular Weight 9908.84 Da.
    Residues 86 Isoelectric Point 4.37
    Sequence mpdplmyqqdnfvvletnqpeqflttielleklkgelekisfsdlplelqkldslpaqaqhlidtscel dvgagkylqwyavrlek
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2krx
    1. Solution NMR structure of Asl3597 from Nostoc sp. PCC7120, the first structure from protein domain family PF12095, reveals a novel fold
    EA Feldmann, TA Ramelot, Y Yang - Proteins: Structure, , 2012 - Wiley Online Library
     
    2. Protein Physics by Advanced Computational Techniques: Conformational Sampling and Folded State Discrimination
    PC Tejada - 2011 - sissa.it
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch