.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ks0

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution NMR structure of the Q251Q8_DESHY(21-82) protein from Desulfitobacterium Hafniense, Northeast Structural Genomics Consortium Target DhR8C. To be Published
    Site NESGC
    PDB Id 2ks0 Target Id DhR8C
    Related PDB Ids 2kyi 3ipf 
    Molecular Characteristics
    Source Desulfitobacterium hafniense
    Alias Ids TPS31790,16656, PF07873, - Molecular Weight 6791.53 Da.
    Residues 62 Isoelectric Point 5.16
    Sequence dnrqflsltgvskvqsfdpkeilletiqgvlsikgeklgikhldlkagqveveglidalvyp
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 2

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2ks0
    1. Combining NMR and EPR methods for homodimer protein structure determination
    Y Yang, TA Ramelot, RM McCarrick, S Ni - Journal of the , 2010 - ACS Publications
     
    2. Solution NMR structure of Dsy0195 homodimer from Desulfitobacterium hafniense: first structure representative of the YabP domain family of proteins involved in
    Y Yang, TA Ramelot, JR Cort, H Wang - Journal of structural and , 2011 - Springer
     
    3. Influence of 1 H chemical shift assignments of the interface residues on structure determinations of homodimeric proteins
    YJ Lin, DK Kirchner, P Gntert - Journal of Magnetic Resonance, 2012 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch