The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution NMR Structure of the SH3 Domain from the p85beta subunit of Phosphatidylinositol 3-kinase from H.sapiens, Northeast Structural Genomics Consortium Target HR5531E. To be Published
    Site NESGC
    PDB Id 2kt1 Target Id HR5531E
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS31844,, 16681 Molecular Weight 10049.95 Da.
    Residues 91 Isoelectric Point 7.94
    Sequence magpegfqyralypfrrerpedlellpgdvlvvsraalqalgvaeggercpqsvgwmpglnertrqrgd fpgtyveflgpvalarpgprpr
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch