.
The Open Protein Structure Annotation Network
PDB Keyword
.

2kt7

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution NMR structure of mucin-binding domain of protein lmo0835 from Listeria monocytogenes. To be Published
    Site NESGC
    PDB Id 2kt7 Target Id LmR64A
    Molecular Characteristics
    Source Listeria monocytogenes
    Alias Ids TPS31830,16686 Molecular Weight 10543.19 Da.
    Residues 95 Isoelectric Point 4.36
    Sequence adtnnftvkveyvdadgaeiapsdiltdyhyvstpkdipgyklreiphnatgnitdtgiivryiydkti dvryvdetgkdllpvveiinseaavl
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2kt7
    1. Microbial adhesins to gastrointestinal mucus
    N Juge - Trends in Microbiology, 2011 - Elsevier
     
    2. Fold and Function of the InlB B-repeat
    M Ebbes, WM Bleymller, M Cernescu, R Nlker - Journal of Biological , 2011 - ASBMB
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch