.
The Open Protein Structure Annotation Network
PDB Keyword
.

2kt9

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution NMR Structure of Probable 30S ribosomal protein PSRP-3 (Ycf65-like protein) from Synechocystis sp. (PCC 6803), Northeast Structural Genomics Consortium Target Target SgR46. To be Published
    Site NESGC
    PDB Id 2kt9 Target Id SgR46
    Molecular Characteristics
    Source Synechocystis sp. pcc 6803
    Alias Ids TPS31753,BIG_294, PF04839, 16691 Molecular Weight 12637.64 Da.
    Residues 112 Isoelectric Point 5.00
    Sequence mttaeaastvhtsfilkvlwldqnvaiavdqivgkgtspltsyffwpradawqqlkdeleakhwiaead rinvlnqatevinfwqdlknqnkqismaeaqgkfpevvfsgsn
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2kt9
    1. Characterizing Protein Shape by a Volume Distribution Asymmetry Index
    N Arrigo, P Paci, L Di Paola, D Santoni - Open Bioinformatics , 2012 - benthamscience.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch