The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution Structure of GmR58A. To be Published
    Site NESGC
    PDB Id 2kut Target Id GmR58A
    Molecular Characteristics
    Source Geobacter metallireducens
    Alias Ids TPS33474,16746, PF07705 Molecular Weight 11476.26 Da.
    Residues 109 Isoelectric Point 8.34
    Sequence dlpitlsketpfegeeitvsarvtnrgaaeahnvpvavylgnpaqggveigrdtisripvggtglarvq wkatrklagraanpgvpvyavvdpdnrvaesdkannvfsr
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch