.
The Open Protein Structure Annotation Network
PDB Keyword
.

2kvo

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution NMR structure of Photosystem II reaction center Psb28 protein from Synechocystis sp.(strain PCC 6803), Northeast Structural Genomics Consortium Target SgR171. To be Published
    Site NESGC
    PDB Id 2kvo Target Id SgR171
    Molecular Characteristics
    Source Synechocystis sp. pcc 6803
    Alias Ids TPS33490,PF03912, 16782 Molecular Weight 12589.66 Da.
    Residues 112 Isoelectric Point 4.96
    Sequence maeiqfskgvaetvvpevrlskskngqsgmakfyfleptilakestdditgmyliddegeiitrevkgk fingrptaieatvilnsqpewdrfmrfmerygaenglgfskse
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2kvo
    1. Solution NMR structure of photosystem II reaction center protein Psb28 from Synechocystis sp. strain PCC 6803
    Y Yang, TA Ramelot, JR Cort, D Wang - Proteins: Structure, , 2011 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch