.
The Open Protein Structure Annotation Network
PDB Keyword
.

2kvs

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title NMR Solution Structure of Q7A1E8 protein from Staphylococcus aureus: Northeast Structural Genomics Consortium target: ZR215. To be Published
    Site NESGC
    PDB Id 2kvs Target Id ZR215
    Molecular Characteristics
    Source Staphylococcus aureus
    Alias Ids TPS54491,PF06855, 16793, 1.10.150.260 Molecular Weight 7901.52 Da.
    Residues 67 Isoelectric Point 5.40
    Sequence mtfynfimgfqndntpfgilaehvsedkafprleerhqvirayvmsnytdhqliettnraislyman
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2kvs
    1. Three structural representatives of the PF06855 protein domain family from Staphyloccocus aureus and Bacillus subtilis have SAM domain-like folds and different
    GVT Swapna, P Rossi, AF Montelione - Journal of structural and , 2012 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch