.
The Open Protein Structure Annotation Network
PDB Keyword
.

2kvu

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Northeast Structural Genomics Consortium Target HR4547E. To be Published
    Site NESGC
    PDB Id 2kvu Target Id HR4547E
    Related PDB Ids 2kw9 
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS33498,1.10.720.30, 16792, PF02037, 16816 Molecular Weight 5840.45 Da.
    Residues 54 Isoelectric Point 8.34
    Sequence gkpgalpanlddmkvaelkqelklrslpvsgtktelierlrayqdqispvpgap
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2kvu
    1. Small angle X_ray scattering as a complementary tool for high_throughput structural studies
    TD Grant, JR Luft, JR Wolfley, H Tsuruta, A Martel - , 2011 - Wiley Online Library
     
    2. Prdiction de structures de macromolcules par apprentissage automatique
    A Marcos Alvarez - 2011 - orbi.ulg.ac.be
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch