.
The Open Protein Structure Annotation Network
PDB Keyword
.

2kvz

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of residues 161-235 of putative peptidoglycan binding protein lmo0835 from Listeria monocytogenes: target LmR64B of the Northeast Structural Genomics Consortium. To be Published
    Site NESGC
    PDB Id 2kvz Target Id LmR64B
    Molecular Characteristics
    Source Listeria monocytogenes
    Alias Ids TPS55062,16801 Molecular Weight 7099.79 Da.
    Residues 63 Isoelectric Point 6.32
    Sequence fgkpnqvtvnyldenktpiapslylsglfneaynvpmkkikgytllkydseilgvftespqti
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2kvz
    1. Small angle X_ray scattering as a complementary tool for high_throughput structural studies
    TD Grant, JR Luft, JR Wolfley, H Tsuruta, A Martel - , 2011 - Wiley Online Library
     
    2. Fold and Function of the InlB B-repeat
    M Ebbes, WM Bleymller, M Cernescu, R Nlker - Journal of Biological , 2011 - ASBMB
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch