.
The Open Protein Structure Annotation Network
PDB Keyword
.

2kw5

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution NMR Structure of the Slr1183 protein from Synechocystis sp. PCC 6803. Northeast Structural Genomics Consortium Target SgR145. To be Published
    Site NESGC
    PDB Id 2kw5 Target Id SgR145
    Related PDB Ids 3mer 
    Molecular Characteristics
    Source Synechocystis sp. pcc 6803
    Alias Ids TPS54850,3.40.50.150, PF08241, 3.40.50.720, 16806, PF03848 Molecular Weight 21314.08 Da.
    Residues 194 Isoelectric Point 4.76
    Sequence mwderfsqseyvygtepndflvsvanqipqgkilclaegegrnacflaslgyevtavdqssvglakakq laqekgvkittvqsnladfdivadawegivsifchlpsslrqqlypkvyqglkpggvfilegfapeqlq yntggpkdldllpkletlqselpslnwliannlernldegayhqgkaaliqllgqk
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2kw5
    1. Determination of solution structures of proteins up to 40 kDa using CS-Rosetta with sparse NMR data from deuterated samples
    OF Lange, P Rossi, NG Sgourakis - Proceedings of the , 2012 - National Acad Sciences
     
    2. Structural insights into functional modes of proteins involved in ubiquitin family pathways.
    P Hnzelmann, A Schfer, D Vller - Methods in molecular , 2012 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch