.
The Open Protein Structure Annotation Network
PDB Keyword
.

2kw6

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution NMR Structure of Cyclin-dependent kinase 2-associated protein 1 (CDK2-associated protein 1; oral cancer suppressor Deleted in oral cancer 1, DOC-1) from H.sapiens, Northeast Structural Genomics Consortium Target HR3057H. To be Published
    Site NESGC
    PDB Id 2kw6 Target Id HR3057H
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS54920,PF09806, 16808 Molecular Weight 6185.80 Da.
    Residues 55 Isoelectric Point 9.42
    Sequence skyaellaiieelgkeirptyagsksamerlkrgiiharglvreclaeternars
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 2

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2kw6
    1. Influence of 1 H chemical shift assignments of the interface residues on structure determinations of homodimeric proteins
    YJ Lin, DK Kirchner, P Gntert - Journal of Magnetic Resonance, 2012 - Elsevier
     
    2. Personalized View Selection of 3D Molecular Proteins
    N Doulamis, E Chronis, G Miaoulis - Computer Graphics 2010, 2010 - Springer
     
    3. Order and disorder in proteins
    A Ertekin - 2011 - mss3.libraries.rutgers.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch