.
The Open Protein Structure Annotation Network
PDB Keyword
.

2kw7

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution NMR Structure of the N-terminal domain of protein PG_0361 from P.gingivalis, Northeast Structural Genomics Consortium Target Target PgR37A. To be Published
    Site NESGC
    PDB Id 2kw7 Target Id PgR37A
    Molecular Characteristics
    Source Porphyromonas gingivalis
    Alias Ids TPS55102,16810, PF04536 Molecular Weight 13627.77 Da.
    Residues 124 Isoelectric Point 5.56
    Sequence gllsnaqeevmngrlrairsshavefavvtlpsigdapledftlklarqwgvgneknnnglllvlvldq rrvrfetgyglegylpdgllsriihdrmiphfrsgnyaeglsegvlavqqvldgs
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2kw7
    1. Small angle X_ray scattering as a complementary tool for high_throughput structural studies
    TD Grant, JR Luft, JR Wolfley, H Tsuruta, A Martel - , 2011 - Wiley Online Library
     
    2. Solution NMR structures reveal a distinct architecture and provide first structures for protein domain family PF04536
    A Eletsky, TB Acton, R Xiao, JK Everett - Journal of Structural and , 2011 - Springer
     
    3. Positive modulation of a Cys-loop acetylcholine receptor by an auxiliary transmembrane subunit
    T Boulin, G Rapti, L Briseo-Roa, C Stigloher - Nature , 2012 - nature.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch