.
The Open Protein Structure Annotation Network
PDB Keyword
.

2kxy

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of SuR18C from Streptococcus thermophilus. Northeast Structural Genomics Consortium Target SuR18C. To be Published
    Site NESGC
    PDB Id 2kxy Target Id SuR18C
    Molecular Characteristics
    Source Streptococcus thermophilus
    Alias Ids TPS55039,16927, PF07949 Molecular Weight 8788.51 Da.
    Residues 82 Isoelectric Point 5.21
    Sequence vpvkleltgdkasnvssisysfdrghvtivgsqeamdkidsitvpvdisqvtedtsktlelkaegvtvq pstvkvnlkvtqk
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2kxy
    1. Structures of domains I and IV from YbbR are representative of a widely distributed protein family
    AW Barb, JR Cort, J Seetharaman, S Lew - Protein , 2011 - Wiley Online Library
     
    2. Blind prediction of quaternary structures of homo-oligomeric proteins from amino acid sequences based on templates
    M Morita, M Kakuta, K Shimizu, S Nakamura - 2012 - hoajonline.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch