.
The Open Protein Structure Annotation Network
PDB Keyword
.

2kyr

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of Enzyme IIB subunit of PTS system from Escherichia coli K12, Northeast Structural Genomics Consortium target ER315/Ontario Center for Structural Proteomics target ec0544. To be Published
    Site NESGC
    PDB Id 2kyr Target Id ER315
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS54428,PF02302, 16979, 3.40.50.2300 Molecular Weight 11734.65 Da.
    Residues 108 Isoelectric Point 4.40
    Sequence mskklialcacpmglahtfmaaqaleeaaveagyevkietqgadgiqnrltaqdiaeatiiihsvavtp ednerfesrdvyeitlqdaiknaagiikeieemiaseqq
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch