.
The Open Protein Structure Annotation Network
PDB Keyword
.

2kyw

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution NMR Structure of a domain of adhesion exoprotein from Pediococcus pentosaceus, Northeast Structural Genomics Consortium Target PtR41O. To be Published
    Site NESGC
    PDB Id 2kyw Target Id PtR41O
    Molecular Characteristics
    Source Pediococcus pentosaceus
    Alias Ids TPS55067,16988 Molecular Weight 7717.76 Da.
    Residues 75 Isoelectric Point 3.54
    Sequence tamdedatityvdddkggaqvgdivtvtgktddsttytvtipdgyeyvgtdggvvssdgktvtitfaad dsdnvv
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2kyw
    1. Assessment of protein structure refinement in CASP9
    JL MacCallum, A Prez, MJ Schnieders - Proteins: Structure, , 2011 - Wiley Online Library
     
    2. Microbial adhesins to gastrointestinal mucus
    N Juge - Trends in Microbiology, 2011 - Elsevier
     
    3. Blind prediction of quaternary structures of homo-oligomeric proteins from amino acid sequences based on templates
    M Morita, M Kakuta, K Shimizu, S Nakamura - 2012 - hoajonline.com
     
    4. How Accurately Can We Model Protein Structures with Dihedral Angles?
    X Cui, S Li, D Bu, B Alipanahi Ramandi, M Li - Algorithms in Bioinformatics, 2012 - Springer
     
    5. Protein Physics by Advanced Computational Techniques: Conformational Sampling and Folded State Discrimination
    PC Tejada - 2011 - sissa.it
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch